PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10022136
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 1021aa    MW: 113264 Da    PI: 5.3671
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10022136genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.61.4e-184692148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT+eEde+l +av+++ g++Wk+Ia+++   Rt+ qc +rwqk+l
      Lus10022136 46 KGQWTAEEDEILRQAVHRFKGKNWKKIAECFK-DRTDVQCLHRWQKVL 92
                     799****************************9.************986 PP

2Myb_DNA-binding666.8e-2198144148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+W++eEde++v+ v+++G++ W+tIa++++ gR +kqc++rw+++l
      Lus10022136  98 KGPWSKEEDEIIVEMVHKYGPKKWSTIAQHLP-GRIGKQCRERWHNHL 144
                      79******************************.*************97 PP

3Myb_DNA-binding46.49.2e-15150192145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      + +WT++E+  lv+a++++G++ W+   + ++ gRt++ +k++w+
      Lus10022136 150 KEAWTQDEEVALVRAHQMYGNR-WAELTKFLP-GRTDNAIKNHWN 192
                      579*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.1714192IPR017930Myb domain
SuperFamilySSF466899.33E-164298IPR009057Homeodomain-like
SMARTSM007171.2E-154594IPR001005SANT/Myb domain
PfamPF002493.0E-164692IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-2348104IPR009057Homeodomain-like
CDDcd001671.96E-144992No hitNo description
PROSITE profilePS5129433.52893148IPR017930Myb domain
SuperFamilySSF466895.87E-3195191IPR009057Homeodomain-like
SMARTSM007171.4E-1997146IPR001005SANT/Myb domain
PfamPF002493.9E-1998144IPR001005SANT/Myb domain
CDDcd001672.50E-17100144No hitNo description
Gene3DG3DSA:1.10.10.608.5E-28105147IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.9E-21148199IPR009057Homeodomain-like
PROSITE profilePS5129418.789149199IPR017930Myb domain
SMARTSM007172.5E-14149197IPR001005SANT/Myb domain
PfamPF002498.1E-13150193IPR001005SANT/Myb domain
CDDcd001677.63E-11152192No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
GO:0003713Molecular Functiontranscription coactivator activity
Sequence ? help Back to Top
Protein Sequence    Length: 1021 aa     Download sequence    Send to blast
MRSTTALGRF EDEDRWTRQS MEAVALLTSE GRIKRRTSGP TRRSTKGQWT AEEDEILRQA  60
VHRFKGKNWK KIAECFKDRT DVQCLHRWQK VLNPELVKGP WSKEEDEIIV EMVHKYGPKK  120
WSTIAQHLPG RIGKQCRERW HNHLNPSINK EAWTQDEEVA LVRAHQMYGN RWAELTKFLP  180
GRTDNAIKNH WNSSVKKKLD SYLASGLLEQ FQGLPLVVHQ NQPTPSSSSR LQNSGDDNDS  240
GRMCGTVAEE ITEWRKEETV RACSQSANDL GNSIIRSGEE FQLTQDSGHG ENQNHHAGNC  300
SVQYYTSRAI VPFSIPEAPF EADCSSNFLQ QNYPHIAVNS ARADYHISIV EQGFSGVPSH  360
GIAAHESQET ANVPSHASMS FQGPVPMEDM AASSTTREQI LISDDECCKI LFLETQTVGG  420
NIPQNRMEDS HMVDLDGSNH SLPYPSSNNH INPPRCGILE TQCSQSFPHN LVTPSNDENH  480
ICSQKQSQFV TSFGAHDQDF IASVNDIVFI SDDNNVANSF RANGENNSEM QEESYLKEAS  540
RLVAGDSATL PCPTGVNQKM DVDQQNTGSL CYEPPRFPGL DLPFFSCDLV QSDSDLQQEY  600
SPLGIRQFMV SSVNCISPFR LWDSPTRSSS PDAVLKSAAK SFMGTPSILK KRTRDLLSPL  660
SERRKDKKLE VDMTSSLTKE FQRLDVMFEE AESRKPHAMS PLSSQEINEV SCSEDKENVD  720
PALIHGRDGD IVSVDGKEKP RDVSTISEDD VDRNNTQENA KKEINCIGPK TKDHSGVDPQ  780
IPSEVLGEDS LNDLLLFSPD AQTPRNWHRR ILATLSEKVV NSVSSSGNRS TGSPAVYKMN  840
DGHIVAATET KANENTVAST GNDGVIGNLN IFGGTPFKRS IESPSGWKSP WFINSFIPGP  900
RVDTDISVED IGYFLSPGDR SYDAITLLKQ FSEHTAAACA DALEVLGDET PGTISKARHP  960
KNPNSEEERD NVSHLANIAT ECRVLDFSEC GTPEKGKENA KSSPVAISMS SPSCMLKSFR  1020
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C1e-67461996159MYB PROTO-ONCOGENE PROTEIN
1h89_C1e-67461996159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1661668ERRKDKKL
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00466DAPTransfer from AT4G32730Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002516567.10.0PREDICTED: myb-related protein 3R-1 isoform X1
SwissprotQ9S7G70.0MB3R1_ARATH; Myb-related protein 3R-1
TrEMBLB9RS480.0B9RS48_RICCO; Myb, putative
STRINGPOPTR_0006s25840.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF37273362
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32730.10.0Homeodomain-like protein